PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 237aa    MW: 27669.4 Da    PI: 7.4302
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490236.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.51.2e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+i+fs++gkl+eys+
  XP_004490236.1  9 KRIENKINRQVTFSKRRTGLLKKANEISVLCDAEVALIVFSHNGKLFEYST 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-33292IPR002100Transcription factor, MADS-box
CDDcd002651.17E-38273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-30323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004046.7E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-2983172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.53588178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGRSKVQLKR IENKINRQVT FSKRRTGLLK KANEISVLCD AEVALIVFSH NGKLFEYSTD  60
SCMEKILERH ERYGYAERLL VTNDSETQEN WSIEYTRLKA KIDLLQRNHR QYLGEDLASM  120
SLKELQCLEQ QLDTGLKSIR TRRNQVLYEA ISELQKKEKG IQEQNNMLTK EIKEKEKAVA  180
QEAAAQWDQP NYRVDTSFLL QDPLPVLNMG GNYREGAQEL GRNELDLTLE PQYYYNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-20273171Myocyte-specific enhancer factor 2A
3mu6_C2e-20273171Myocyte-specific enhancer factor 2A
3mu6_B2e-20273171Myocyte-specific enhancer factor 2A
3mu6_A2e-20273171Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0517450.0BT051745.1 Medicago truncatula clone MTYF5_F6_F7_F81G-O-5 unknown mRNA.
GenBankBT1491430.0BT149143.1 Medicago truncatula clone JCVI-FLMt-16M7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490236.11e-175PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotD7KWY61e-108AP1_ARALL; Floral homeotic protein APETALA 1
TrEMBLG7JX121e-136G7JX12_MEDTR; MADS-box transcription factor
STRINGGLYMA16G13070.11e-133(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58832119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-98MIKC_MADS family protein